txeis.net valuation and analysis
Robots.txt Information
| Robot | Path | Permission |
| GoogleBot | / | ✔ |
| BingBot | / | ✔ |
| BaiduSpider | / | ✔ |
| YandexBot | / | ✔ |
Meta Tags
| Title | Your access to this site has been limited by the site owner |
| Description | |
| Keywords |
Server Information
| Website | |
| Host IP |
173.201.79.55 97.74.111.55 |
| Location | United States |
Find software alternatives
| The best software alternatives |
More to Explore
| ravenhawksmagickalmysticalplaces.com |
| 1st.ir |
| classiccasualhome.com |
| eecu.org |
| msms.org |
| thrunite.com |
| gloryleague.basketball |
| physiciansapply.ca |
| bestcamping.com |
| pitsolutions.com |
txeis.net Valuation
|
US$12,202
Last updated: January 13, 2024
txeis.net has global traffic rank of 573,666. txeis.net has an estimated worth of US$ 12,202, based on its estimated Ads revenue. txeis.net receives approximately 13 unique visitors each day. Its web server is located in United States, with IP address 173.201.79.55. According to Statvoo, txeis.net is trusted to visit. View more about Txeis.net on W3. |
Traffic & Worth Estimates
| Purchase/Sale Value | US$12,202 |
| Daily Ads Revenue | US$9 |
| Monthly Ads Revenue | US$254 |
| Yearly Ads Revenue | US$3,051 |
| Daily Unique Visitors | 13 |
| Note: All traffic and earnings values are estimates. | |
Traffic Ranks
| Global Rank | 573,666 |
| Delta (90 Days) | 0 |
| Most Popular In Country | N/A |
| Country Rank | N/A |
DNS Records
| Host | Type | IP | Nameserver |
| txeis.net | A | 173.201.79.55 | pdns12.domaincontrol.com. |
| txeis.net | A | 97.74.111.55 | pdns11.domaincontrol.com. |
Domain Name Misspellings
| rxeis.net | fxeis.net |
| gxeis.net | hxeis.net |
| yxeis.net | tzeis.net |
| taeis.net | tseis.net |
| tdeis.net | tceis.net |
| txwis.net | txsis.net |
| txdis.net | txfis.net |
| txris.net | txeus.net |
| txejs.net | txeks.net |
| txels.net | txeos.net |
| txeiq.net | txeiw.net |
| txeie.net | txeiz.net |
| txeix.net | txeic.net |
HTTP Headers
keep-alive
0
Sat, 13 Jan 2024 13:31:44 GMT
awselb/2.0
0
|
txeis.net Whois Information
| Domain Name | TXEIS.NET txeis.net |
| Registrar | Amazon Registrar, Inc. |
| Whois Server | whois.registrar.amazon.com |
| Referral Url | |
| Updated Date | 2023-08-09 04:26:36 |
| Creation Date | 2007-07-24 14:21:48 |
| Expiration Date | 2025-09-02 03:59:59 |
| Name Servers | PDNS11.DOMAINCONTROL.COM PDNS12.DOMAINCONTROL.COM |
| Status | clientDeleteProhibited https://icann.org/epp#clientDeleteProhibited clientTransferProhibited https://icann.org/epp#clientTransferProhibited clientUpdateProhibited https://icann.org/epp#clientUpdateProhibited |
| Emails | [email protected] [email protected] |
| Dnssec | unsigned |
| Name | On behalf of txeis.net owner |
| Org | Identity Protection Service |
| Address | PO Box 786 |
| City | Hayes |
| State | Middlesex |
| Registrant Postal Code | UB3 9TR |
| Country | GB |